PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK41291.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family G2-like
Protein Properties Length: 357aa    MW: 39633.5 Da    PI: 8.0888
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK41291.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-32214269156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  KFK41291.1 214 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 269
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.086211271IPR017930Myb domain
SuperFamilySSF466899.86E-18211272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-28212272IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26214269IPR006447Myb domain, plants
PfamPF002495.7E-8216267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MMLQNMEIDY AKKMQKCHEY VEALEEEQKK IQVFQRELPL CLELVTQAIE ACRKELSNTS  60
EQTHVGQSEC SEQTTSVCGG GHVFEEFIPI KRNEEDGEHE STPPPPEKKS DWLRSVQLWN  120
PSPDPNPKDV SDSDRVVLVA KKAKVVEVKP KSGAFKPFLK EKQRVLETQP PVVNSALVPV  180
PATTTSSTTE TGGVDKEREE ALQRDQSQSQ THRKQRRCWS PELHRRFLHA LQQLGGSHVA  240
TPKQIRDHMK VDGLTNDEVK SHLQKYRLHT RRPATSVAAQ SNGSPQQPQF VVVGGIWVPS  300
SQDVANNGAG IYAPMGAQQP PLSPQSPKRS MERSSGRCNS TAASSSTNTT TTSSPVS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0638865e-73AY063886.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
GenBankAY0879935e-73AY087993.1 Arabidopsis thaliana clone 40196 mRNA, complete sequence.
GenBankAY0912415e-73AY091241.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391112.11e-155hypothetical protein EUTSA_v10018737mg
TrEMBLA0A087HGN90.0A0A087HGN9_ARAAL; Uncharacterized protein
STRINGBra038360.1-P1e-145(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-132G2-like family protein